DPCstruct | MC18972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 149 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 68.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 50.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04829 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A7Q779 | 56-212 | DAANKVLDTYGLGGKVQLAVRAVTGVLQGIATGDASQATVGGLSPYINHQIKEATTDKDGNVNLEANLMAHALLGVIEAYATGNNAA… |
| A0A0A2VER1 | 4-132 | YGTGSAIQQGIQAATAAVQGLAGGDLSKAIAGGAAPYLAEIIHKKTTDPITGEVNTEANLMAHAVLGAVVAKIQGNNALSGAAGATT… |
| A0A4D0SKI1 | 40-192 | None |
| A0A836YR34 | 2-148 | None |
| A0A4R6E2N3 | 131-278 | None |
| A0A478KN71 | 10-145 | None |
| A0A806X923 | 185-335 | None |
| A0A1B8YDV8 | 70-217 | None |
| A0A1X1EMT5 | 4-152 | None |
| A0A1B8YJU0 | 2-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.