DPCstruct | MC18971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B5FU87 | 3-90 | LDERMKAAGMMPVSEMLEKDPLGKFAAHAGVTDLESFEQWIQQRRAEFLRMQAQMTLDGEEKDEMFEWVVAHNAVLAEVIANFRQATG |
| A0A6F8V3X7 | 43-135 | GGDIDARMKAAGMIPLSDLISGNTPLERWAAHTGVSDLDTFEEWLTRKQREFGVMKAGYELGDKDKGDELYEWVLSHFAAFNEVAAN… |
| A0A4S5CPC9 | 4-100 | None |
| A0A1H5A476 | 11-131 | None |
| A0A512IS35 | 59-153 | None |
| A0A418XEL7 | 106-230 | None |
| A0A7U2YPH4 | 75-175 | None |
| A0A2R4ME53 | 114-206 | None |
| A0A1L7NMF8 | 1-89 | None |
| A0A2R5F982 | 9-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.