DPCstruct | MC1897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 20.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2T1N9 | 7-168 | SETIHLRVQPLSKLLLEGLANAANTTSTRIIEDLILEAAKEDEVVDIDEIIDDRFLKNGKLSLIDALTAAYHSEEPILTKLRTYYLA… |
| A0A7Y7XJJ0 | 24-179 | RPKKSDQPTVNVSLRIDPKIKFAIDLLCREQKRSITGVIEWSIMQALKSQMVTTSKGDEISMFQLMEWAWSPDEAERVTLLGIVAPH… |
| A0A368XF96 | 1-153 | None |
| A0A7W8J8A9 | 1-129 | None |
| A0A533REJ9 | 4-136 | None |
| A0A0P9IYZ5 | 1-164 | None |
| A0A7U7J266 | 1-162 | None |
| A0A4Q7RI75 | 33-215 | None |
| A0A2A2DJ66 | 8-154 | None |
| A0A4R5IXR0 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.