DPCstruct | MC18965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2LSC7 | 1-73 | MEHADDIAVDQFAAAMREKMKRSREKGRGGWADKTLCSEKSLSQMLREHVEKGDPVDVANFCMMLHHRGEKIV |
| A0A6F8UQB6 | 7-96 | FERPWERAERDQIANKAGIKRLKEAMKAKLAAARLKGRGGWQDKDDCSQEHLSKLLREHVEKGDPVDVANFCMMLHARGETILPVAR… |
| A0A0Q0E9N4 | 2-77 | None |
| A0A854ET05 | 94-188 | None |
| A0A7V8F6S6 | 157-239 | None |
| A0A1S7RUB2 | 74-171 | None |
| A9ID08 | 53-147 | None |
| A0A837UXV3 | 80-169 | None |
| A0A1E7X6Q3 | 3-92 | None |
| A0A1B4G139 | 482-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.