DPCstruct | MC18964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1VN65 | 87-173 | SQVTIKLQPLFKRSITYLTKNDSDLGDQVESFGQEHEFGDITWYPSQRTAVYRIDDRVATNTCGNGLYDFTPFRSTLSAEVGVVRSL |
| A0A6A6MN42 | 229-307 | QPLFKRSITYVVKNDKGLGDEASSFGLKHEFADISWYPSQHKAVYRIDDRISSNTSGNGLYDIIQFRSTLSVGLALVRT |
| A0A835RND5 | 347-425 | None |
| A0A3L6QG11 | 164-244 | None |
| A0A484KQ71 | 1-78 | None |
| A0A484KKC9 | 230-311 | None |
| A0A3B6KUW2 | 1-78 | None |
| A0A3P6DB21 | 1-90 | None |
| D8QRU0 | 39-125 | None |
| A0A2G3AV56 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.