DPCstruct | MC18963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 106 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803KZE7 | 44-142 | WFEIRLFYVRIAPCAIDAAPDYLTLRHLRDELGVSLEINGNRVPASETASSTLRRDRVDRESSEVTYVSTDNVKISGGVEFEVCEMD… |
| A0A498JF22 | 4-109 | EGSDLRTHRSSNGRMLLAMVTPCVTGSVPDHLKLRHLRCEIGVSLEINKTRVPASDSASLMLRRDRVYKESSEVMYVSIDSVRVIGG… |
| M0ZGX4 | 13-120 | None |
| A0A5N6PTZ1 | 33-140 | None |
| A9T096 | 11-117 | None |
| A0A7J6EFQ0 | 29-138 | None |
| A0A484K1V1 | 5-111 | None |
| A0A834Z849 | 22-130 | None |
| A0A6A3CGP6 | 19-111 | None |
| A0A446XI40 | 5-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.