DPCstruct | MC18960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Standard deviation of domain lengths | 15.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1J9B5 | 205-359 | LIVAMVFEGWLIKVVSSKKIIPSGFFNVFTFGDNYVSATGTWRGVNQKIAYPVNAAKIECFKDQRICREANAELADSALMVNTTEWQ… |
| A0A5C5Q2C2 | 2-123 | IIKQQGDDLMLWGGWGTVAGYEPPGVNAVEIRCNRGSGRCLEAYASILHHDEGEDLEAQVFNYEVVEWTEQILHATGVMPHADCVTL… |
| A0A1H6NW39 | 156-302 | None |
| A0A848EEW7 | 245-387 | None |
| A0A524IP37 | 126-260 | None |
| A0A5C8NSK0 | 58-229 | None |
| A0A1E3YFH5 | 69-215 | None |
| A0A7X1KCJ1 | 4-189 | None |
| A0A2V2R9V6 | 16-149 | None |
| A0A315XCA7 | 3-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.