DPCstruct | MC1896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 374 |
|---|---|
| Mean domain length (aa) | 292 ± 57 aa |
| Standard deviation of domain lengths | 56.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.74 |
| Pfam Score | 94.64 |
| Assigned Pfam label(s) | CL0023- PF05157- PF17854- CL0306- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A429ZEE2 | 10-302 | LLKEGYSQRISDIYLFPHPKGYQITFRQNNQQRLYRQIDQSLGEKVLVHLKYLADMDVAEKRRMQVGSATYPLDEKVALRLRFSTVA… |
| I9XES1 | 2-215 | SSNLANGERVQIVLSPVTVNDETISISIRIPSKTTYPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSI… |
| A0A1C2JMI4 | 259-460 | None |
| A0A833IZU9 | 297-540 | None |
| A0A7Y5AZ47 | 102-419 | None |
| A0A348XDW8 | 300-601 | None |
| A0A812YN14 | 8-305 | None |
| A0A2N0EX20 | 11-246 | None |
| A0A1T1D669 | 263-559 | None |
| A0A7W0SKA4 | 10-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.