DPCstruct | MC18958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 158 ± 25 aa |
| Standard deviation of domain lengths | 25.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B0RYF9 | 61-213 | PAGVDPASIDCAAEFALAQGVVPPAEEPPSTEGQEAPAPTRVGDDAEAVAVLRCSQQTGEAADTGRTTFAVVLERLEGDLDTVLAEL… |
| A0A494T2M5 | 2-143 | ADSADCMAENVYTGITGLGPWDTAITDDVPEPGYPPPYFEPVAMARCEISLTADNVETLDTVRLDGDVDAVMDAFRVDSKRYSDFVS… |
| A0A4P6UCR7 | 1-129 | None |
| A0A544YQL5 | 16-171 | None |
| A0A7K0QV46 | 78-253 | None |
| A0A0M4LN78 | 15-151 | None |
| A0A7Z6PMH1 | 58-219 | None |
| A0A260AZ79 | 1-116 | None |
| A0A3N9XI52 | 1-157 | None |
| G8S4S6 | 19-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.