DPCstruct | MC18955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 198 ± 20 aa |
| Standard deviation of domain lengths | 20.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5TMJ1 | 25-199 | PREIIELLLAEHALRELKQREEALKQRSIALQKAKAIESDSSELEDANAQLDETRKQIPRKEHDLYGAVSMLTSVLRKDYDSLRRNT… |
| A0A1L9N0B3 | 19-231 | VLIKIENHLERTGRWKTAQRMRYKQVIWQMIDCTKTCEAVLFLLENDMRHLEILQREAFLKAECQRITKTQLSEDDQEQLEAWYKEL… |
| A0A2V5HYC5 | 17-246 | None |
| A0A1V6SR23 | 14-269 | None |
| A0A0F4Z3S2 | 36-227 | None |
| A0A1R3S0S7 | 3-185 | None |
| A0A0A2KE54 | 35-222 | None |
| A0A1L9WJJ7 | 19-188 | None |
| B8N0R0 | 2-171 | None |
| A0A0F4YYM0 | 54-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.