DPCstruct | MC18954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 174 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7J3F0 | 73-276 | AMVITNLSISSYVYYHAFWKGHFNMWFTAPDLGDHPTTILLLNVSWYYLILRLSECIETILFVLRKRFRQVSTLHVFHHVSVTFSVY… |
| A0A182MJJ4 | 50-232 | LFIVWIGPKIMRDYICEPCRQSFHPMELRIVDAVWWYYFSKVLEFSDTFFFILRKKDNQLTFLHVYHHSTMFSFWWIGVKVPDAFLP… |
| A0A7J6PHA4 | 342-518 | None |
| A0A7R9LXH6 | 11-179 | None |
| A0A1A9VN85 | 1-149 | None |
| H0V6Y4 | 22-178 | None |
| A0A6P5VRW2 | 24-204 | None |
| A0A3Q0ILV5 | 26-214 | None |
| A0A0K0E4Q6 | 34-185 | None |
| A0A1D2NH43 | 78-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.