DPCstruct | MC1895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4JUD0 | 82-149 | YSFANRQDKVLYEWKKRGDFQVQQISGKAETFVCFRCGYPVRSNLQVIKNENWDWRMCYPCYQRVVQT |
| A0A2W2PBA1 | 12-70 | IVKVYPPRDGMQLVRLGAVAPFTCSRCTQAKKARLVAVQGDALFCNGCYGRVEASAQER |
| N8Q3G5 | 6-60 | None |
| S9V100 | 67-133 | None |
| A0A5N6TFZ9 | 1-69 | None |
| A0A6P2WBI7 | 2-71 | None |
| A0A263D348 | 26-76 | None |
| A0A558ACU6 | 9-61 | None |
| A0A6A6XWJ3 | 47-119 | None |
| A0A0B7KJV1 | 13-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.