DPCstruct | MC18948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 201 ± 18 aa |
| Standard deviation of domain lengths | 17.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6YL94 | 599-833 | TSCVKYVDYVEANKILRLVVDQYLKFHEYTKALILAIQLNDKKMANKIFAECQNGLVLRQMAFIATRQQFLIDLDPNIVDRDDLLNI… |
| A0A5D2PI08 | 1-224 | MRQSEDASVDDLMELVEQIVAFHMEHVCDVFTSCDGLLMKKQFCYILARQGINFELDDDMVKDDEDRELSQVIINNIKLSESYLTLA… |
| A0A0B1SFI3 | 85-272 | None |
| A0A183HHB6 | 3-192 | None |
| A0A287XHG4 | 167-384 | None |
| F4Q5A0 | 268-451 | None |
| A0A267E222 | 10-201 | None |
| A4I449 | 271-449 | None |
| A0A183B842 | 1-198 | None |
| A0A813K8H6 | 165-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.