DPCstruct | MC18947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 138 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 50.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2PF30 | 17-157 | PRSNLGESSTCLTVYKEGGAPAVFQSPKCPRWKIPNHDSGERSPTTATGRCQSAVLQGRRKHMEDRTVCMLDLHIPFPSKIGVKEVS… |
| A0A6P4A6U2 | 30-154 | STCLTLYKEGGAPAVFQSPKCPRWKLSSYASRSPSTARCQSAMLQGRRKSQEDRTLCVLDLTVPFPGKVGIKEVTVGVVAVFDGHGG… |
| A0A443NNT0 | 26-139 | None |
| A0A1U7ZVM9 | 28-143 | None |
| A0A834HS15 | 36-240 | None |
| A0A2P2IPI4 | 35-159 | None |
| A0A1D6F745 | 34-186 | None |
| A0A446XQB5 | 22-170 | None |
| A0A843U994 | 26-165 | None |
| A0A067FMN3 | 38-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.