DPCstruct | MC18946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 280 ± 21 aa |
| Standard deviation of domain lengths | 21.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NB66 | 2-263 | DKYTACVWPRLEPFLIGVLPATPPSKFSMHYLRKMACYVRTRDGCFPRLGWHMWRHIACGKLQLAEELAWLYFETFDLLMPRSAEQR… |
| A0A5D2P5E6 | 1-274 | MTDPIGPSTSTIPNPSPTTLLHPRREPFEHGLLPMQKLIFTDPLQALTSLKQKLVSSSIQRVDSAALADALQISLDHARLVLDTLAS… |
| G3P2Z6 | 6-291 | None |
| A0A4Y7ICR5 | 4-311 | None |
| A0A6S7NP75 | 6-295 | None |
| A0A3Q0KKA2 | 1-306 | None |
| A0A7M3RDD6 | 12-260 | None |
| A0A7G2ESB1 | 7-295 | None |
| A0A1Q9EZ63 | 2-241 | None |
| A0A024GTJ0 | 5-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.