DPCstruct | MC18940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 141 ± 28 aa |
| Standard deviation of domain lengths | 27.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5CKL0 | 25-144 | GEDHNPPLPKDNSICLVCHINFETEDIAATHLKQGMTCAHCHGVSSVHANDEEAAAKPDILFGRSEVEPFCRKCHTEHKNPEAVKKF… |
| A0A1G3A523 | 1-131 | MDHAPSAAGPAATGATAAAGENQACFICHVNYQDEPLVTVHAAQNIGCAKCHGESHPHRSDENNTTPPDIMYPAAAIAPACRKCHET… |
| A0A1G2Z0D5 | 1-126 | None |
| A0A7V3T8V1 | 62-199 | None |
| A0A7V3TWU9 | 172-319 | None |
| A0A7X7FMK4 | 1-98 | None |
| A0A7C7V8Z4 | 1-223 | None |
| A0A286RC03 | 78-221 | None |
| A0A7C4MZV2 | 65-204 | None |
| A0A0S8JRD9 | 15-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.