DPCstruct | MC18939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 149 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19959 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H9H0I1 | 1-176 | MPKKSYGETVEKRVKRLFEVLLDHVAHCQCEDNDWGVKLALGEEGKLLRVETNLAALVRLAEQKGEKLTKDQVRDAISHYLADYLGI… |
| A0A846CLI6 | 1-152 | MARTGNWGDVPLKRAKKLIEFLISYSQINDERDKLSTEWIDRNSDRPKLKITTKLKELACLLNPEISSRYSSEANKQKNEIQNTIDR… |
| A0A3M2GEH7 | 1-148 | None |
| A0A354WD56 | 13-156 | None |
| B4VPV7 | 1-147 | None |
| A0YSB1 | 4-160 | None |
| A0A0K1RUJ7 | 2-134 | None |
| E0UL31 | 1-136 | None |
| A8ZND2 | 1-161 | None |
| A0A7X6HP64 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.