DPCstruct | MC18936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 316 ± 47 aa |
| Standard deviation of domain lengths | 47.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0507- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8RN33 | 189-504 | SAAGFGVAEADAGKFEKGIRELLGPGYAAAAERLAEGIAAERPGEEVCVEEILGTARVYEVQGRCDFYGGRPAVWRTGRGDKVSAVA… |
| A0A3M2TFW7 | 1-350 | MIAKAGAGPDPIPHASLSCDNLAPAIQFCLTPEATAAAGEISVKMQAESGVAAAVDSFHGNLPLDRMRCAVMPNQVAAWTYKKARRP… |
| A0A146F8I2 | 1-326 | None |
| A0A4Y8D5X3 | 51-356 | None |
| X8IYD8 | 2-270 | None |
| A0A2V1BNU1 | 81-351 | None |
| A0A4S8XCW8 | 129-514 | None |
| A0A821PSK3 | 20-329 | None |
| A0A178ABK3 | 449-851 | None |
| A0A365N1C4 | 146-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.