DPCstruct | MC18933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 131 ± 26 aa |
| Standard deviation of domain lengths | 26.19 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.09 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0123- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2MQ05 | 325-445 | ETPRRARESWMYEKAANIRKLGGERWDPKKKLSPEALEGIRALHAQDSERFSTPNLARHFEVSPEAIKRILKSKWKPTAEEAVKRDL… |
| A0A3M2T9S2 | 1-131 | MEKPHPQSKASKEHSGEKSDETKTEEKKQEGWQLQKEALKNKFKEGWNPLRKVSPDAIEGIRQLHAAAPQQFKTPVLAEQFKLSPDA… |
| A0A3N4KR87 | 228-399 | None |
| A0A162MUC3 | 80-234 | None |
| A0A0F7SAU6 | 257-403 | None |
| A0A099NZM5 | 23-169 | None |
| A0A4Q2DH20 | 77-221 | None |
| W2S3C6 | 65-219 | None |
| A0A1Z5SM85 | 62-191 | None |
| A0A7J7S5B0 | 3-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.