DPCstruct | MC1893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6GJC8 | 72-164 | RKAIDPPSARKLVEGAVAYARGFGLAPHPNYKAACRVFGGTNAAESTTSFNFGRNGKPFYIQGRYDSFEKALRMMNHLRARCGNDGF… |
| A0A2W2N6P1 | 1-75 | MAYARTFGFEPAPDFAQVSVHLGEPGPATPRIGFGRQGKPFYINGPRDDVQKIVRTLERTCGAGNYHYVPGTGPL |
| A0A6I7W6P3 | 19-114 | None |
| A0L716 | 185-275 | None |
| A0A523I3Z5 | 53-138 | None |
| A0A6J4HSY5 | 155-248 | None |
| R7J3E3 | 99-188 | None |
| A0A3C0B6Z7 | 102-179 | None |
| A0A3D1CX33 | 94-188 | None |
| B0BYZ3 | 8-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.