DPCstruct | MC18929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.51 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0763- PF05943 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4TQ32 | 60-182 | MPRFLARLPYGEDTEPAEAFAFEEFTDESGHDEYLWSNGCFAVAQLLARTYSEFGWNFGGRFVQDVDGLPLHVFKKDGETVYQSCAE… |
| A0A350F0K3 | 1-128 | MPRFLLRQPYGKAGDPIERFAFEEITDDADHERFLWGNSAVLCAQLLAEGHAAGEQIAAGNIGDLQPAHYTEHGGTALKACAEAWLV… |
| A0A1C9I4G9 | 136-269 | None |
| A0A6A5KZZ0 | 233-382 | None |
| A0A651HRC5 | 167-307 | None |
| A0A7V3JJY5 | 240-356 | None |
| A0A2V9Y1N7 | 130-246 | None |
| A0A1B8YI14 | 183-329 | None |
| A0A7Y2Y043 | 512-656 | None |
| A0A447WC42 | 263-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.