DPCstruct | MC18927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1C322 | 1-114 | MCGDESEYALFSYSRDICSRNHRRFTLCGFHNTEEHKGDWKTCKKCREDFEPEMYVWYGMNEYNFEKLPNPPAFKPTYCFKCGERIV… |
| A0A350EWE9 | 10-141 | PQCGLCGKSGKLVRTPCCGNWICDDQDKYALFSFARNSCARNHDRLTLCGYHHNEGHKGRWQDCGVCRESFETELYVWYGTNEYNFE… |
| F4PTZ2 | 105-256 | None |
| A0A7S3VGF5 | 216-352 | None |
| A0A399YH41 | 119-261 | None |
| A0A1L7XEW2 | 52-189 | None |
| A0A660UM72 | 13-151 | None |
| A0A1Q9N1P7 | 62-200 | None |
| A0A399ZF37 | 130-256 | None |
| A0A2T2W7I7 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.