DPCstruct | MC18924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 216 |
|---|---|
| Mean domain length (aa) | 108 ± 19 aa |
| Standard deviation of domain lengths | 19.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 79.34 |
| Assigned Pfam label(s) | CL0233- CL0299- PF05610- PF01521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U6KQS0 | 2-81 | IEMTERAAQHVQDFLDNRGKGEGIRVGIRTAGCSGLAYVLEFVDIPDENDTRYESRGVSIFIDPKSLVYLDGLLMDYEKK |
| A0A2E9EZT4 | 4-108 | CTLTDAAKQQIDTICKENEVYAVTLNMKGGGCAGFEYKWGTYKTADELLDDDEVFTTDNKNVFVIGGASIMFLFGTVIDYKKDIMGS… |
| A0A7R8X5Z7 | 3-84 | None |
| A0A6V7SGS7 | 181-300 | None |
| A0A1M6STG8 | 48-161 | None |
| A0A158N7W1 | 93-198 | None |
| A0A0N1MCF8 | 6-91 | None |
| A0A0M3IHL7 | 387-494 | None |
| A0A6V7WMJ7 | 29-137 | None |
| A0A6V7WPC2 | 24-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.