DPCstruct | MC18920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 327 ± 78 aa |
| Standard deviation of domain lengths | 77.84 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.58 |
| Pfam Score | 64.44 |
| Assigned Pfam label(s) | CL0169- PF18821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4YV61 | 136-374 | EQDKRAELSDEYETEIAPARDARNTAIEAHEKAFADKWQSLQNEIAKVRGDVSEKLAADNVPQKQRDQVLALETAKLVEQHEVAKHD… |
| A0A737EXE2 | 509-844 | KWKLIHRHINVQSFLKALEHTHGLSSEKYSVSKAKDGADRIRCGNRNYSVTDFLTKELHFSWTEAGQYILSEFSRQQRKGDLHLQVT… |
| A0A345LQZ3 | 481-783 | None |
| A0A1U9XG16 | 35-308 | None |
| A0A2D3T563 | 3-230 | None |
| A0A2D3T8W6 | 25-333 | None |
| A0A2T0HMX8 | 15-263 | None |
| A0A4V1ZV13 | 48-623 | None |
| A0A125SHJ7 | 63-420 | None |
| A0A4Q6CE10 | 4-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.