DPCstruct | MC18917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 74.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YGW1 | 89-139 | MDLIESRWEELVGEMPLKICYPAIESHEWRIVTGCDPKNTRWSYHNGGSWP |
| A0A438I227 | 243-294 | LDLIEDRWEELVGKMPLKLSYPALDIHGWSIETGSDPKNTRWSSQNGGSWPG |
| A0A2N9GN74 | 74-133 | None |
| A0A164Y197 | 452-510 | None |
| A0A0B2P5G1 | 470-527 | None |
| A0A6P3Z5X2 | 227-283 | None |
| A0A6A2YY05 | 241-291 | None |
| D7MPT3 | 133-184 | None |
| A0A4S8J486 | 352-405 | None |
| A0A4S8JCZ2 | 937-995 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.