DPCstruct | MC18916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 59.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443S4I1 | 2-92 | AFRSFGHLLRYGDAPIKRAVPLALALISISNPKLNILETLSKFSHDSDTEVACNAIFAMGLIGAGTNNARLSTMLRQLAQFHNKEAN… |
| A0A6I9P5R0 | 23-132 | IAMGEEIGSEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSHNSIFAMGMVGSGESPHTHPIETC… |
| A0A7J6YL94 | 1027-1128 | None |
| A0A7R9DCF2 | 71-144 | None |
| A0A0A9XYD3 | 4-79 | None |
| G3I308 | 2-75 | None |
| A0A7J8LQ48 | 253-355 | None |
| A0A267E222 | 423-524 | None |
| A0A2C6L2A5 | 42-138 | None |
| A0A813K8H6 | 523-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.