DPCstruct | MC18915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 115 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835M630 | 12-116 | YYHNNQLVRNDNPKKKNMSSGSSPINIQGNATSSRSWSSYSDSSDESDQFEDEDQEMVPPHVLVARRNARKSTAFSVCTGNGRTLKG… |
| A0A2K3MVB4 | 142-248 | QRPSSDRTPSFSSPASSQFYHSAPVNVPMMSPEMAKLARQYEEEDARALVEEEEFRNTMPPHEYLSRQVEFSPMLSCSLFEGVGRTL… |
| A0A804IZ44 | 61-183 | None |
| A0A151TN23 | 58-156 | None |
| A0A0V0HQ73 | 9-99 | None |
| A0A4P1RM76 | 110-208 | None |
| A0A6I9RNR4 | 21-142 | None |
| I1JQ45 | 111-218 | None |
| A0A2G3BBL5 | 57-164 | None |
| A2WV17 | 11-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.