DPCstruct | MC18913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 157 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287Q3B1 | 2-151 | AQLLDERDLGVLTSVMSLFVSLVSNNAEAYWNCLPKCVRILERMARNQDIPQEYTYYGIPSPWLQVKAMRALQYFPTIEDPSARRAL… |
| A0A3P6V027 | 7-163 | DFVKQSAALCLLKLFRTAPDIIQPGEYASRIVHLLNDSHMGVVTSAASLIESLSKKWPDEYKGCVPLAISRLSRIVTATYTDLQDYT… |
| A0A5A8DMH1 | 165-313 | None |
| A0A437DJL6 | 157-320 | None |
| A0A2I0LDN1 | 98-220 | None |
| A0A6S7MZW0 | 1-140 | None |
| A0A446X3F1 | 140-304 | None |
| B4DDL1 | 4-170 | None |
| A0A444U4I9 | 312-475 | None |
| A0A183BJ20 | 157-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.