DPCstruct | MC18912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 168 ± 29 aa |
| Standard deviation of domain lengths | 29.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 98.04 |
| Assigned Pfam label(s) | PF05340- PF05266- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835LYG2 | 1-168 | MMHSSPSQHIEAILPLPCRSLPFRKSSLMWGSIEFMEVFKVLPQQPHLCPLEQYNEEAREGIAIGKMLIFANLVKETMELQLDVPRS… |
| A0A6J0KXG4 | 3-152 | LPFEKKLPIWKRVESMEVYKRFPQSPHFIPLLESREDCREMSAVGMMLTFSGLLEEVKTLQLNSPISSLNSLSDSFAELEKHGFDVQ… |
| A0A6P6GHZ4 | 1-158 | None |
| A0A2G5DR35 | 346-548 | None |
| A0A6D2HF37 | 1-131 | None |
| A0A164YXB3 | 2-163 | None |
| A0A0K9QNR6 | 131-314 | None |
| A0A803Q3L3 | 340-545 | None |
| A0A565CJ37 | 5-110 | None |
| A0A2G5DDW1 | 6-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.