DPCstruct | MC18911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 328 ± 67 aa |
| Standard deviation of domain lengths | 67.08 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 53.58 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | PF00223- PF05695 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444ZBV9 | 29-297 | WPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGL… |
| A0A835LXS6 | 10-372 | VKILVDRDPVKTSFEEWARPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLIEISRKVFSAHFGQLSIIFLWLSGMYFHGSRFS… |
| A0A0B2PS33 | 2-303 | None |
| A0A2G3ASB3 | 28-408 | None |
| A0A2G2XC02 | 1-313 | None |
| A0A2G2XBU1 | 4-357 | None |
| A0A5D2KKH8 | 6-333 | None |
| A0A2G3CRL2 | 3-265 | None |
| A0A1R3KZI6 | 3-287 | None |
| A0A4S8I2Y4 | 1-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.