DPCstruct | MC18909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 178 ± 36 aa |
| Standard deviation of domain lengths | 36.32 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 67.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2GXU0 | 1-154 | MPKPNLVPENETEEEKFERRQREKNAIIESDIANAADLFSGVKVTDEVVTSASKLETMKPKTKEQFAEFTTELVALIQKHEKQGLYV… |
| A0A835LT79 | 20-173 | KYAYNDEDVEDNEEKSTLVGAPAPKQNTRKSVEKKGTNENPLAEKLRQQRLVEEADYKLTTELFGNTDDEKSLDNFIPKSESDFSEY… |
| A0A183WYY1 | 5-175 | None |
| A0A251RPB5 | 23-173 | None |
| A0A3B3VJZ3 | 7-239 | None |
| A0A1Y1WD79 | 37-237 | None |
| L8Y420 | 48-291 | None |
| T1FWB9 | 23-178 | None |
| A0A1B0B6F1 | 21-195 | None |
| A0A078HN04 | 80-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.