DPCstruct | MC18908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6NK36 | 31-109 | VDKSNATAIQAAEDPVKYEYVFDVRGNLASEPVAPVDAASMQSAESQVLGRTQRGGPAAVMQSAANVNVRAGLVDPDDA |
| A0A3Q7I7G3 | 24-107 | QDQPQRPEREQPLKYGDCFNVKGDLADQPIAPQDAAMMQSAEAMVFGKNQKGGPASVMQAAAAKNERSGHVSHDATTQLAGDEG |
| A0A5B6VQB7 | 391-474 | None |
| A0A445CKK4 | 1-84 | None |
| A0A843WPS9 | 1-79 | None |
| A0A6A5LM60 | 533-618 | None |
| A0A5B6VZT2 | 200-279 | None |
| G7ITI3 | 43-127 | None |
| A0A2S1WLT2 | 13-96 | None |
| A0A1U8P0B3 | 64-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.