DPCstruct | MC18906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 206 ± 31 aa |
| Standard deviation of domain lengths | 30.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0023- PF20442 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842QXQ7 | 9-220 | LDELDKKIRDHFRNRVVRKSYATSVPVLKKLPRYISEFIVNQHSDENGFLRKDVLEEIVNDLKKFFPEKKDKELYKSRALELGTVDL… |
| N9XW46 | 2-178 | DELSMKLNQHFAGKVVRKDLTQKLKQGANVPIYVLEYLLGMYCATDDEDSINAGVERVKNILADNFVRPDEAEKIKSKIREMSRYTV… |
| A0A7C5NX37 | 229-436 | None |
| A0A7T8NSE3 | 2-205 | None |
| A0A822IWU5 | 5-234 | None |
| R6PR53 | 2-218 | None |
| A0A101GRU6 | 5-237 | None |
| E4THI1 | 1-264 | None |
| A0A7C7VMU8 | 628-852 | None |
| A0A7X7AWF9 | 50-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.