DPCstruct | MC18903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 367 ± 59 aa |
| Standard deviation of domain lengths | 59.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4UIK9 | 1-281 | MEKEDELLFNFFTHISQLSFEKAKELVERDKPPKCPVTPRTMFSNFLQQLALAEKSYMDIGFLQNKQKSFLRKDNSLRAVYEYMKND… |
| A0A5E4M323 | 6-328 | QEIVRIYFKYLTQTNFDKAKDFMERQRSVLLSSVWPKPLFNILCDFAVAEKNYSDTNFEPEKNKLVARKEDENYLDFVYKTLFQDLG… |
| A0A6A4K5Q4 | 476-821 | None |
| A0A085MCA0 | 692-1031 | None |
| E2B150 | 5-335 | None |
| A0A7J5ZF82 | 5-340 | None |
| A0A7E4S460 | 63-453 | None |
| A0A2I1DZY6 | 571-1015 | None |
| E4XXZ9 | 81-433 | None |
| L8GUN6 | 2-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.