DPCstruct | MC18902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 158 ± 28 aa |
| Standard deviation of domain lengths | 27.76 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6G7S0 | 48-143 | DKADDTATTALFPEKESRNFHKRWTDIQTAFVDEPRRAVERADELVAEVIKRLADSFAQERSNLEGQWGRGDNVSTEDLRVALQRYR… |
| A0A7C3NKM8 | 18-143 | DAEPEAERVRESTSDRPMVTADAAKVPPQVTHGNGEQRNPLFSNDEERNFRERWQNVQTGFVDEPRQAVEHADELIAEILQHLAQRF… |
| A0A101JPG3 | 204-372 | None |
| A0A1B1ZSF9 | 186-331 | None |
| A0A7W5VAC4 | 54-227 | None |
| A0A3E2YKU6 | 195-316 | None |
| A0A7W9PPZ7 | 171-330 | None |
| A0A2W6BLJ7 | 1-93 | None |
| A0A838ECS8 | 13-169 | None |
| A0A810NTF3 | 440-594 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.