DPCstruct | MC18901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 634 ± 108 aa |
| Standard deviation of domain lengths | 108.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843BMB3 | 128-684 | LDDTTDRMTGMVAPSEDEIYGLLHGRNKPILILMDEILPYVESAAGHTVGKTNMAVQTNTFMQRLSNKVQALPNVCVVVSLPDREDT… |
| A0A7C3NIN0 | 52-671 | LKAAAGTLGEGTPDNIRLAFLQLIFRANGLPENLAAAKFVLWLRERNLWEKISTHLKNKKRDPAQEIRNFYVSTPLAEALVAADSGY… |
| A0A843DG66 | 85-675 | None |
| A0A430E171 | 115-618 | None |
| A0A1V1PBJ6 | 152-704 | None |
| A0A7C1J700 | 229-933 | None |
| A0A535ELP7 | 12-803 | None |
| I3Y789 | 55-634 | None |
| A0A397S6S4 | 6-839 | None |
| A0A7K0AR51 | 86-746 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.