DPCstruct | MC1890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 137 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R9E6T3 | 17-160 | LAPVDPLIAFYWARLDEAETKARAAAQTFGGAPDWQFQRLTDDDFGTDYFLHVADRTIPAATRPGEEDTGPFVASELALIADRDPQA… |
| D6AJZ3 | 74-198 | NADMVAFVRARLADEEHVALAAGGDRWRCPADVPGEVHDRTGGVAFTVRGRGFDQHIALQNPARTLERIETNRVMLGEYVEVADLDT… |
| A0A561WAQ8 | 2-154 | None |
| A0A221NL44 | 8-132 | None |
| A0A2S9Q347 | 3-142 | None |
| A0A367F9D9 | 50-171 | None |
| A0A853CIA8 | 24-126 | None |
| A0A1H9U3R6 | 2-131 | None |
| A0A1T3P514 | 65-229 | None |
| A0A5P2CQQ6 | 3-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.