DPCstruct | MC18898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9ZPR3 | 49-161 | LKTVGITGVKNSGLVKAKHSTGRKLTDVCDLVIDTCVPVGDAAIWIDGLEYPVGPMSTIANSAIVNMIKVRVAELLTLQGKPPLVIT… |
| A0A7C3K468 | 1-117 | MITIGITSRSFADVLPKDHPSRHPSGKNLYQEVDHFLNCHLPYGDAVVEIKGCLQKTGPTSTFCNVFTINLLMIETVKRLMEMEIQP… |
| A0A535E6V6 | 60-155 | None |
| A0A1G6QN46 | 1-107 | None |
| A0A6G6WMT1 | 40-145 | None |
| A0A7W7D416 | 84-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.