DPCstruct | MC18897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3K228 | 1-72 | LSSVSNRLNSVMKVLTIIATIFMPLTFLAGIYGMNFKYMPELEWRWGYPLVWLIMAGIGISMLVYFRKKKWL |
| A0A832XIS1 | 60-138 | AEILDSYLSVVSNNMNEVMKVLTVIATIMLPLTLITGIYGMNFRNMPELYWQNGYYITLGIMATLGISMWMYFKKRGWV |
| R7BXE7 | 3-77 | None |
| A0A7C4HP65 | 554-625 | None |
| A0A496R3G5 | 157-227 | None |
| A0A6A3NBF7 | 855-925 | None |
| A0A0S4JKD2 | 411-481 | None |
| A0A645C7V0 | 59-130 | None |
| A0A2C1KCH8 | 93-168 | None |
| A0A7W1R9J5 | 56-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.