DPCstruct | MC18895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5IIU0 | 12-76 | VVAKANCTLVAYSTKSVAVFGDTQPIINQLKEMGGSFNSRLTLNGKKVEGWIFPKSKEPRLAYYF |
| A0A6C0H482 | 1-68 | MSGIYIEEYSPKSFVVRGNTKDYKDSLLALGGKWNSSLTDKKSGDKFGAWLFWGDKQNQISEWIEKGC |
| A0A6C0JQG2 | 1-60 | None |
| A0A2V3PYH8 | 221-294 | None |
| R7JK54 | 105-184 | None |
| A0A3E4Z6Y5 | 305-374 | None |
| A0A7X6URS8 | 110-175 | None |
| D1K5B5 | 161-229 | None |
| A0A7Z6S1R0 | 100-173 | None |
| A0A060R8M2 | 490-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.