DPCstruct | MC18893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1842 |
|---|---|
| Mean domain length (aa) | 152 ± 26 aa |
| Standard deviation of domain lengths | 25.61 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 16.29 |
| Pfam Score | 97.65 |
| Assigned Pfam label(s) | CL0125- CL0244- CL0043- CL0037- PF10844 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1FEV7 | 5-151 | IEKFIKLLESELGYKEKGNGYTKFGKWYNSVDSKYDYSKLPWCDMFISWAAKKLGYEEWIGQFAWTPSHARWFEKQDAFGKKPEVGA… |
| D1AQ23 | 15-170 | FGFSKKTYDETKFRQELIDWASSKVGAAYSMENRWGENTYDCSSFISRGLRETGMISVSGKKSDYGTTARGLYNNSGQKIEKDDYGL… |
| A0A356U9Z0 | 151-329 | None |
| A0A486XG52 | 22-157 | None |
| A0A1Y4TRB5 | 265-445 | None |
| A0A2N3I0H2 | 102-311 | None |
| A0A4R2JQG8 | 239-407 | None |
| A0A3E2YGG4 | 4-120 | None |
| A0A2N2C4L7 | 4-184 | None |
| A0A537IE92 | 49-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.