DPCstruct | MC18890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 670 |
|---|---|
| Mean domain length (aa) | 301 ± 67 aa |
| Standard deviation of domain lengths | 66.72 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 14.64 |
| Pfam Score | 94.85 |
| Assigned Pfam label(s) | CL0258- PF04557- PF19269- PF03485- CL0600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2ZYY1 | 3-231 | IEKYLNTTPEEVGSRRHDIWLGISLGNKYFTAEHMERYITWALAHTKERVLIVIGDAIQAVNIEVLDSRTPHHALKRARKLGDEQHA… |
| A0A3D3JH12 | 15-270 | RENPPGESPTVSSAVVRTRIAPTPSGLLHVGTAVNFYLTWLFGRLNDGEVLLRIDDADPNMRQQEYVDDIRESIKWLGLEVDQALPY… |
| A0A2C9JDH4 | 58-390 | None |
| H2G178 | 21-322 | None |
| A0A0D3GPK6 | 4-234 | None |
| A0A0G0VWE4 | 2-246 | None |
| A0A4U9HS14 | 7-269 | None |
| A0A0V0QA80 | 219-540 | None |
| A0A0V0QMA6 | 20-343 | None |
| A0A419J0E0 | 248-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.