DPCstruct | MC18888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 243 ± 39 aa |
| Standard deviation of domain lengths | 38.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3C3E8 | 1-239 | MSNKTYNDLLCETSEILVEATQADEAIFEAGATERTVLQPLLSEIRIRYTVLLARLDTVYDQLLQPQKRIIVRRLLEGCLGRLIEIK… |
| A0A672RUP1 | 2-226 | WNAAQGALEDLLEDEYPTMQLRPQKDCLQVFQTLATFYLRYLKIFRALEEVYDRIVHPQKRRVVHQVLEGVMGRLVELKNEMVELEY… |
| A0A7F8RMP0 | 8-199 | None |
| A0A091DJZ8 | 87-321 | None |
| A0A2C9K6B4 | 37-268 | None |
| A0A814PW24 | 6-238 | None |
| A0A7I0ZXQ9 | 242-561 | None |
| W6KX48 | 25-354 | None |
| L5K3U9 | 22-263 | None |
| A0A2C9KRR4 | 6-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.