DPCstruct | MC18882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 143 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4KVK5 | 7-148 | FFPYTNHSIVDLSALQIYQEVNPKNYSDNCFVYACIQSGEFIDLEIETLQMEIKTKKLPNERINDIDKHFRCNFAVKRIDKETGVMQ… |
| A2GQE9 | 30-166 | RNGQLWTWTCKLPINLERYQIFNELNAETAKKMMKDSCFIYACIQAGVDEATINHMREIIRVKDFPMSKIKVIAKETGIRFHVIKYN… |
| M3UM00 | 258-383 | None |
| A2H5M8 | 67-211 | None |
| A2F349 | 370-491 | None |
| A0A1V9YD97 | 79-227 | None |
| A2EHN0 | 309-445 | None |
| A2HVJ9 | 195-327 | None |
| A2H948 | 215-355 | None |
| A2H917 | 83-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.