DPCstruct | MC1888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12843 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848U9A3 | 7-74 | TTLSAEVLAAATMPMPFGRFKGTRLIDLPEPYVVWFKGQGFPTGLLGQRLALMYEIKANGLEKLIRPL |
| A0A8A7W5E3 | 13-87 | RLLMEIHATHMPFGMFGKEKHPPKGVPIYDLPEEYLMWFKQREFPKGRLGELMAHVCEIKECGMDSLFDPMRKAN |
| A0A7X7MIH9 | 2-88 | None |
| A0A7X7KN29 | 9-90 | None |
| A0A4Q6FQS3 | 5-72 | None |
| A0A1M5BQJ6 | 69-137 | None |
| A0A375FJ97 | 1-61 | None |
| A0A7C7ZHL8 | 7-87 | None |
| A0A4Q0NPK6 | 2-73 | None |
| A0A2S7TM54 | 2-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.