DPCstruct | MC18878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 323 ± 61 aa |
| Standard deviation of domain lengths | 60.72 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4GF44 | 17-241 | QRLQDVLDKSLDSLAPLYTGSLDSLEPQVVLGNAEACLAHVQKGIGSISRPAATDAIGKAKKSMATLEKKIRQLRKVYPGNTAVKID… |
| A0A409YEX9 | 308-626 | RWISSYERRVHRSPMIEDEVNSPQSCCPPPSPPSPPAMNAEDQQLMQHLEELHMQVVSAEQIAGNHPIFFHQPPSSATQIRTSTMQS… |
| A0A6A4GIS8 | 269-693 | None |
| A0A146HNU8 | 38-471 | None |
| A0A0C9U529 | 63-298 | None |
| A0A6A4GE12 | 108-365 | None |
| A0A6A4GKG6 | 62-387 | None |
| B0CYK7 | 354-690 | None |
| A0A6A4H072 | 35-406 | None |
| A0A4Y9Y6P3 | 4-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.