DPCstruct | MC18875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4KL10 | 56-164 | IDLPDSASIDRPENFDNRNANPLSVSDADRCLLTQELSSEASVEPCYLLNQRLWSHGDLLTRLEWAWGMEYNSLDPTSESNKIYLRR… |
| A0A409VL13 | 4-103 | IQPLSQGAIERAALADPNGQRCLIENCSKNRAVVPTHLLDRILSADSAFMSAVEWSLGMTKGTLRLDTRRNIFFVGASIRELYQQKR… |
| A0A0C9WKR8 | 27-139 | None |
| A0A4S4M0G1 | 125-234 | None |
| A0A165YNZ8 | 1-130 | None |
| A0A4Y7SB27 | 21-112 | None |
| A0A409Y925 | 6-115 | None |
| A0A409WQB8 | 4-103 | None |
| A0A369KD05 | 4-132 | None |
| A0A5C3QNV4 | 8-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.