DPCstruct | MC18872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 170 ± 13 aa |
| Standard deviation of domain lengths | 12.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L3I901 | 642-806 | PNFELLLFIAQATGAFVVTDSHHRWTEMCAASHRDAGIVLPRIPNTSNFAATTNMPLCEDVQAVSVMLDGGKLGAHRKWIDELYRQL… |
| A0A2E2XEB3 | 208-369 | MSSIAPNYEMSLFIAQVTGSVIVTDSETRWTEFEATQHREQGVANHPWSSLYGTLDSMPLDYDAIDLWKKSSKREYTNTREFMKAAD… |
| J3BFS2 | 1-170 | None |
| A0A5E4Z0R5 | 232-408 | None |
| A0A844HXB5 | 378-541 | None |
| A0A1F7JF85 | 275-473 | None |
| A0A738AJI1 | 73-223 | None |
| A0A853SQX6 | 110-276 | None |
| A0A6G8NK98 | 161-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.