DPCstruct | MC18871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 48.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534WHM6 | 243-367 | KTAVDQPSQTDVFCGFCSDPTSTTFKNPPVACTSDADCAAFTTGCGGNPCTACKQATGGAFRKPAARTITETGAPAGNLTDGVGHAA… |
| A0A534RIQ4 | 3-112 | CGFCGFCGQQFSPSFQGPPAVPCTADAQCTIAPFTKCRQRTSGAFGQGPARTITEVGTPAGVCLGDGAAHTSTLVSTFCIPPAFNAT… |
| A0A534WPV5 | 170-298 | None |
| A0A534V417 | 153-272 | None |
| A0A2V7T330 | 367-493 | None |
| A0A534U426 | 10-136 | None |
| A0A534U1X9 | 45-135 | None |
| A0A534T9A5 | 554-710 | None |
| A0A534T4M1 | 2-122 | None |
| A0A534SNL6 | 191-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.