DPCstruct | MC1887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3K056 | 2-67 | RRFLLIRMEDLTGISGTGEVAEGTVFSSGLAVIRWLKKPYAMTIYQSLDDVLLIHGHEGRTKLQFI |
| A0A2B5A902 | 62-139 | KAKGKDRLREYYLQRNEDFSGVSGTGIVAEGVVMPSGKCIHEWSQSYVVSHNIYPNVQSVQHIHGHEGRTIVKFVGEE |
| A0A2R6D5T8 | 41-123 | None |
| A0A350PI96 | 2-73 | None |
| D9UUK7 | 78-158 | None |
| A0A6B0GJG5 | 7-78 | None |
| A0A351D2B7 | 2-92 | None |
| A0A1V2KNL5 | 4-87 | None |
| A0A366CSG3 | 1-73 | None |
| A0A1S1RLK4 | 6-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.